Structure of PDB 8b4c Chain D Binding Site BS02

Receptor Information
>8b4c Chain D (length=108) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVIS
RNDLHDFVWREQGFEVDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGY
QLIARVET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b4c ToxR activates the Vibrio cholerae virulence genes by tethering DNA to the membrane through versatile binding to multiple sites.
Resolution2.07 Å
Binding residue
(original residue number in PDB)		S37 N38 W64 V71 S74 Q78 P101 K102
Binding residue
(residue number reindexed from 1)		S32 N33 W59 V66 S69 Q73 P96 K97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8b4c, PDBe:8b4c, PDBj:8b4c
PDBsum8b4c
PubMed37428913
UniProtP15795|TOXR_VIBCH Cholera toxin transcriptional activator (Gene Name=toxR)

[Back to BioLiP]