Structure of PDB 8ajy Chain D Binding Site BS02

Receptor Information

>8ajy Chain D (length=84) Species: 641112 (Ruminococcus flavefaciens FD-1)

YRLGDVDFNGIIDGRDATAVLTEYARISTGKPAEFVGNTALAADVNKDNM
IDAADATHILTYYAISSTRDDITSDDYFALHQPL

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 8ajy Chain D Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ajy Structure-function studies can improve binding affinity of cohesin-dockerin interactions for multi-protein assemblies.
• Resolution: 1.71 Å
• Binding residue (original residue number in PDB): D70 N72 D74 M76 D81
• Binding residue (residue number reindexed from 1): D44 N46 D48 M50 D55
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 16:34:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8ajy', asym_id = 'D', bs = 'BS02', title = 'Structure-function studies can improve binding a...ckerin interactions for multi-protein assemblies.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8ajy', asym_id='D', bs='BS02', title='Structure-function studies can improve binding a...ckerin interactions for multi-protein assemblies.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0000272,0004553', uniprot = '', pdbid = '8ajy', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000272,0004553', uniprot='', pdbid='8ajy', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>