Structure of PDB 7zb5 Chain D Binding Site BS02

Receptor Information
>7zb5 Chain D (length=178) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGITPTLQNIVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLGFNAKFTDFKIQNI
VGSCDIKFPIRLEGLASKHHNFSSYEPELFPGLIYRMIKPKIVLLIFVSG
KIVLTGAKVREEIYQAFEMIYPVLQDFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zb5 Structural basis for TBP displacement from TATA box DNA by the Swi2/Snf2 ATPase Mot1.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q83 N84 F114 R120 T127 L129 T139 P206 F222 V228
Binding residue
(residue number reindexed from 1)		Q8 N9 F39 R45 T52 L54 T64 P131 F147 V153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zb5, PDBe:7zb5, PDBj:7zb5
PDBsum7zb5
PubMed37106137
UniProtG0SAL6

[Back to BioLiP]