Structure of PDB 7z34 Chain D Binding Site BS02

Receptor Information
>7z34 Chain D (length=273) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQNTPKYRLVVRFTNKDIIC
QIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQK
LGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGA
LKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELA
DDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTK
EQYAAESKKYRQTKLSKEERAAR
Ligand information
>7z34 Chain 2 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z34 Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K8 F16 T18 F20 R21 R22 R24 E25 T28 R33 N57 K58 I69 T70 D72 V74 Y79 G91 T93 N94 W95 Q151 R152 T155 G156 A157 R158 P181 Y207 Y226 T256 Y265 E268 K270 Y272 R273 K276 L277 R285
Binding residue
(residue number reindexed from 1)		K1 F9 T11 F13 R14 R15 R17 E18 T21 R26 N45 K46 I57 T58 D60 V62 Y67 G79 T81 N82 W83 Q139 R140 T143 G144 A145 R146 P169 Y195 Y214 T244 Y253 E256 K258 Y260 R261 K264 L265 R273
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z34, PDBe:7z34, PDBj:7z34
PDBsum7z34
PubMed36097293
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]