Structure of PDB 7y8w Chain D Binding Site BS02

Receptor Information
>7y8w Chain D (length=84) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWH
CIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Ligand information
>7y8w Chain F (length=24) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FMQHANVATDQVVMKSVECQTEPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y8w Interaction between DLC-1 and SAO-1 facilitates CED-4 translocation during apoptosis in the Caenorhabditis elegans germline.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K36 K43
Binding residue
(residue number reindexed from 1)		K31 K38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0006915 apoptotic process
GO:0007017 microtubule-based process
GO:0030473 nuclear migration along microtubule
GO:0051301 cell division
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y8w, PDBe:7y8w, PDBj:7y8w
PDBsum7y8w
PubMed36323675
UniProtQ22799|DYL1_CAEEL Dynein light chain 1, cytoplasmic (Gene Name=dlc-1)

[Back to BioLiP]