Structure of PDB 7vp3 Chain D Binding Site BS02

Receptor Information
>7vp3 Chain D (length=58) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAE
PAVIAATG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vp3 Structural basis for DNA recognition by TCP transcription factors
Resolution3.003 Å
Binding residue
(original residue number in PDB)		R55 H56 T57 R64 R65
Binding residue
(residue number reindexed from 1)		R5 H6 T7 R14 R15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7vp3, PDBe:7vp3, PDBj:7vp3
PDBsum7vp3
PubMed
UniProtQ9C9L2|TCP15_ARATH Transcription factor TCP15 (Gene Name=TCP15)

[Back to BioLiP]