Structure of PDB 7v08 Chain D Binding Site BS02

Receptor Information
>7v08 Chain D (length=270) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFT
NKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIA
RRTLQKLGLDEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGAS
DGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEE
RFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAA
ESKKYRQTKLSKEERAARVA
Ligand information
>7v08 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v08 rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Resolution2.36 Å
Binding residue
(original residue number in PDB)		K8 S13 S14 F20 R21 R22 R24 T28 Y30 R33 R50 T56 N57 Q63 I65 D72 V74 Y79 H90 G91 N94 W95 R152 T154 T155 G156 R158 Y198 H203 V204 Y207 R218 E221 F223 K224 F253 T256 K258 F260 K262 Q264 Y265 A266 E268 S269 Y272 R273 Q274 K276 K279
Binding residue
(residue number reindexed from 1)		K2 S7 S8 F14 R15 R16 R18 T22 Y24 R27 R44 T50 N51 Q57 I59 D66 V68 Y73 H84 G85 N88 W89 R135 T137 T138 G139 R141 Y181 H186 V187 Y190 R201 E204 F206 K207 F236 T239 K241 F243 K245 Q247 Y248 A249 E251 S252 Y255 R256 Q257 K259 K262
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v08, PDBe:7v08, PDBj:7v08
PDBsum7v08
PubMed36864048
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]