Structure of PDB 7uqz Chain D Binding Site BS02

Receptor Information
>7uqz Chain D (length=270) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFT
NKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIA
RRTLQKLGLDEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGAS
DGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEE
RFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAA
ESKKYRQTKLSKEERAARVA
Ligand information
>7uqz Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		K8 S10 S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I65 D72 V73 V74 Y79 H90 G91 N94 W95 R152 T154 T155 G156 A157 R158 Y198 H203 Y207 R218 E221 L222 F223 K224 F253 P255 T256 K259 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 K279 R282 R285
Binding residue
(residue number reindexed from 1)		K2 S4 S7 S8 T12 F14 R15 R16 R18 K21 T22 Y24 R27 R44 R48 T50 N51 K52 I55 Q57 I59 D66 V67 V68 Y73 H84 G85 N88 W89 R135 T137 T138 G139 A140 R141 Y181 H186 Y190 R201 E204 L205 F206 K207 F236 P238 T239 K242 F243 K245 Q247 Y248 A249 E251 S252 K253 Y255 R256 Q257 K259 K262 R265 R268
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum7uqz
PubMed36864048
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]