Structure of PDB 7tan Chain D Binding Site BS02

Receptor Information

>7tan Chain D (length=93) Species: 9606 (Homo sapiens)

SRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Ligand information

>7tan Chain J (length=147)

gccctggagaatcccggtgccgaggccgctcaattggtcgtagacagctc
tagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcca
aggggattactccctagtctccaggcacgtgtcagatatatacatcc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7tan Multivalent DNA and nucleosome acidic patch interactions specify VRK1 mitotic localization and activity.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): K34 E35 Y40
• Binding residue (residue number reindexed from 1): K3 E4 Y9

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0042802 identical protein binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0002227 innate immune response in mucosa
• GO:0006334 nucleosome assembly
• GO:0019731 antibacterial humoral response
• GO:0042742 defense response to bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0000786 nucleosome
• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7tan, PDBe:7tan, PDBj:7tan
• PDBsum: 7tan
• PubMed: 35390161
• UniProt: P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I (Gene Name=H2BC4)