Structure of PDB 7ta6 Chain D Binding Site BS02

Receptor Information
>7ta6 Chain D (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGL
YLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRAK
PWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Ligand information
>7ta6 Chain N (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KLGWCIGEGGTDPNLNHGQFRGKILMCWK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ta6 Trimer-to-Monomer Disruption Mechanism for a Potent, Protease-Resistant Antagonist of Tumor Necrosis Factor-alpha Signaling.
Resolution2.67 Å
Binding residue
(original residue number in PDB)		P8 L157
Binding residue
(residue number reindexed from 1)		P3 L145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0006955 immune response
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ta6, PDBe:7ta6, PDBj:7ta6
PDBsum7ta6
PubMed35613436
UniProtP01375|TNFA_HUMAN Tumor necrosis factor (Gene Name=TNF)

[Back to BioLiP]