Structure of PDB 7oh3 Chain D Binding Site BS02

Receptor Information
>7oh3 Chain D (length=267) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNK
DIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARR
TLQKLGLDEEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYV
PHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELF
KGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAAESKKYR
QTKLSKEERAARVAAKI
Ligand information
>7oh3 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oh3 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 V52 R54 N57 K58 I61 Q63 I65 I69 T70 D72 V74 Y79 G91 N94 W95 R152 T154 T155 A157 R158 Y198 H203 Y207 R218 E221 L222 K224 P255 K258 F260 K262 Q264 Y265 A266 E268 S269 Y272 R273 Q274 K276 K279 R282 A283 V286
Binding residue
(residue number reindexed from 1)		S2 S5 S6 F8 T10 F12 R13 R14 R16 K19 T20 Y22 R25 R42 V44 R46 N49 K50 I53 Q55 I57 I61 T62 D64 V66 Y71 G83 N86 W87 R129 T131 T132 A134 R135 Y175 H180 Y184 R195 E198 L199 K201 P232 K235 F237 K239 Q241 Y242 A243 E245 S246 Y249 R250 Q251 K253 K256 R259 A260 V263
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oh3, PDBe:7oh3, PDBj:7oh3
PDBsum7oh3
PubMed34813592
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]