Structure of PDB 7lv8 Chain D Binding Site BS02

Receptor Information
>7lv8 Chain D (length=89) Species: 1560514 (Melbournevirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFRLGLRNMLAQIHPDISVQTEALSELSNIAVFLGKKISHGAVTLLPEGT
KTIKSSAVLLAAGDLYGKDLGRHAVGEMTKAVTRYGSAK
Ligand information
>7lv8 Chain J (length=121) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacg
cacgtacggattctcccccgcgttttaaccgccaaggggattactcccta
gtctccaggcacgtgtcagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lv8 The structure of a virus-encoded nucleosome.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		T36 T65 T67
Binding residue
(residue number reindexed from 1)		T21 T50 T52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7lv8, PDBe:7lv8, PDBj:7lv8
PDBsum7lv8
PubMed33927388
UniProtA0A097I2B5|H2B2A_MELV Histone doublet H2B-H2A (Gene Name=MEL_369)

[Back to BioLiP]