Structure of PDB 7lo0 Chain D Binding Site BS02

Receptor Information
>7lo0 Chain D (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEE
YDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYR
GQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHIN
W
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lo0 Tousled-like kinase 2 targets ASF1 histone chaperones through client mimicry.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		D58 V60 L61 V62 M71 F72
Binding residue
(residue number reindexed from 1)		D56 V58 L59 V60 M69 F70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lo0, PDBe:7lo0, PDBj:7lo0
PDBsum7lo0
PubMed35136069
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]