Structure of PDB 7kw7 Chain D Binding Site BS02

Receptor Information
>7kw7 Chain D (length=379) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
AAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKV
QVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDS
QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGG
TFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDI
SQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFE
ELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDF
FNGRDLNKSINPDEAVAYGAAVQAAILMG
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain7kw7 Chain D Residue 702 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kw7 Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		E175 D199
Binding residue
(residue number reindexed from 1)		E172 D196
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001618 virus receptor activity
GO:0001664 G protein-coupled receptor binding
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0019899 enzyme binding
GO:0031072 heat shock protein binding
GO:0031249 denatured protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0038177 death receptor agonist activity
GO:0042826 histone deacetylase binding
GO:0044183 protein folding chaperone
GO:0045296 cadherin binding
GO:0048018 receptor ligand activity
GO:0051082 unfolded protein binding
GO:0051787 misfolded protein binding
GO:0055131 C3HC4-type RING finger domain binding
GO:0097718 disordered domain specific binding
GO:0140416 transcription regulator inhibitor activity
GO:0140545 ATP-dependent protein disaggregase activity
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006402 mRNA catabolic process
GO:0006986 response to unfolded protein
GO:0007041 lysosomal transport
GO:0007165 signal transduction
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0030308 negative regulation of cell growth
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
GO:0031396 regulation of protein ubiquitination
GO:0031397 negative regulation of protein ubiquitination
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032757 positive regulation of interleukin-8 production
GO:0033120 positive regulation of RNA splicing
GO:0034599 cellular response to oxidative stress
GO:0034605 cellular response to heat
GO:0034620 cellular response to unfolded protein
GO:0042026 protein refolding
GO:0043066 negative regulation of apoptotic process
GO:0045648 positive regulation of erythrocyte differentiation
GO:0046034 ATP metabolic process
GO:0046718 symbiont entry into host cell
GO:0050821 protein stabilization
GO:0051085 chaperone cofactor-dependent protein refolding
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0051131 chaperone-mediated protein complex assembly
GO:0070370 cellular heat acclimation
GO:0070434 positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
GO:0071383 cellular response to steroid hormone stimulus
GO:0090063 positive regulation of microtubule nucleation
GO:0090084 negative regulation of inclusion body assembly
GO:1901029 negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
GO:1901673 regulation of mitotic spindle assembly
GO:1902236 negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1902380 positive regulation of endoribonuclease activity
GO:1903265 positive regulation of tumor necrosis factor-mediated signaling pathway
GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005813 centrosome
GO:0005814 centriole
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005925 focal adhesion
GO:0008180 COP9 signalosome
GO:0016234 inclusion body
GO:0016235 aggresome
GO:0016607 nuclear speck
GO:0031982 vesicle
GO:0032991 protein-containing complex
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0072562 blood microparticle
GO:1904813 ficolin-1-rich granule lumen
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kw7, PDBe:7kw7, PDBj:7kw7
PDBsum7kw7
PubMed34937942
UniProtP0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A (Gene Name=HSPA1A)

[Back to BioLiP]