Structure of PDB 7kbf Chain D Binding Site BS02

Receptor Information
>7kbf Chain D (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>7kbf Chain J (length=172) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccagctaggatatcacaatcccggtgccgaggccgctcaattggtcgta
gacagctctagcaccgcttaaacgcacgtacggattccgtacgtgcgttt
aagcggtgctagagctgtctacgaccaattgagcggcctcggcaccggga
ttgtgatatcctagctggccaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kbf Structural features of nucleosomes in interphase and metaphase chromosomes.
Resolution4.42 Å
Binding residue
(original residue number in PDB)		R33 K34 E35 I39 Y40
Binding residue
(residue number reindexed from 1)		R4 K5 E6 I10 Y11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7kbf, PDBe:7kbf, PDBj:7kbf
PDBsum7kbf
PubMed34478647
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]