Structure of PDB 7et6 Chain D Binding Site BS02

Receptor Information
>7et6 Chain D (length=109) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAREVLFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPAMTKGVLINLEDRT
GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQL
YIHWKVRSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et6 TEM1 combinatorially binds to FLOWERING LOCUS T and recruits a Polycomb factor to repress the floral transition in Arabidopsis.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		W259 N260 S261
Binding residue
(residue number reindexed from 1)		W61 N62 S63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7et6, PDBe:7et6, PDBj:7et6
PDBsum7et6
PubMed34446554
UniProtQ9C6M5|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1 (Gene Name=TEM1)

[Back to BioLiP]