Structure of PDB 7co5 Chain D Binding Site BS02

Receptor Information

>7co5 Chain D (length=325) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSYANAVSRAAPAVANLYTTKMVSKPSHPLFDDPMFRRFFGDNLPQQKRM
ESSLGSAVIMSAEGYLLTNNHVTAGADQIIVALRDGRETIAQLVGSDPET
DLAVLKIDLKNLPAMTLGRSDGIRTGDVCLAIGNPFGVGQTVTMGIISAT
GRNQLGLNTYEDFIQTDAAINPGNSGGALVDAAGNLIGINTAIFSKSGGS
QGIGFAIPTKLALEVMQSIIEHGQVIRGWLGVEVKALTPELAESLGLGET
AGIVVAGVYRDGPAARGGLLPGDVILTIDKQEASDGRRSMNQVARTRPGQ
KISIVVLRNGQKVNLTAEVGLRPPP

Ligand information

>7co5 Chain K (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VRDELRWVF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7co5 Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.
Resolution	2.345 Å
Binding residue (original residue number in PDB)	Y70 K100 E103
Binding residue (residue number reindexed from 1)	Y18 K48 E51

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005515	protein binding
GO:0008233	peptidase activity

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7co5, PDBe:7co5, PDBj:7co5
PDBsum	7co5
PubMed	33622718
UniProt	Q9HVX1

[Back to BioLiP]