Structure of PDB 7b23 Chain D Binding Site BS02

Receptor Information
>7b23 Chain D (length=138) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLIDTTEMYLRTIYDLEEEGVVPLRARIAERLEQSGPTVSQTVARMERDG
LLTVAEDRHLELTKAGRARAISVMRKHRLAERLLVDVIGLEWEQVHLEAC
RWEHVMSEAVERKLVKLLGNPTTSPYGNPIPGLDELGV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b23 The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		R27 A28 R29 P39 S42 R60
Binding residue
(residue number reindexed from 1)		R25 A26 R27 P37 S40 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 00:52:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7b23', asym_id = 'D', bs = 'BS02', title = 'The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7b23', asym_id='D', bs='BS02', title='The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677,0003700,0006355,0046914,0046983', uniprot = '', pdbid = '7b23', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355,0046914,0046983', uniprot='', pdbid='7b23', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>