Structure of PDB 6zn5 Chain D Binding Site BS02

Receptor Information
>6zn5 Chain D (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLK
IMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILA
KLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAP
VPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKE
TVFTKSPYQEFTDHLVKT
Ligand information
>6zn5 Chain i (length=29) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPYEDFQENWNTKHSSGVTRELMRELNGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zn5 Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		I109 P111 Q113 T122 E146 V147 I151
Binding residue
(residue number reindexed from 1)		I51 P53 Q55 T64 E88 V89 I93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zn5, PDBe:6zn5, PDBj:6zn5
PDBsum6zn5
PubMed32680882
UniProtP15880|RS2_HUMAN Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]