Structure of PDB 6zfm Chain D Binding Site BS02

Receptor Information
>6zfm Chain D (length=71) Species: 8649 (Naja kaouthia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKT
GVDIQCCSTDNCNPFPTRKRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zfm Peptide Inhibitors of the alpha-Cobratoxin-Nicotinic Acetylcholine Receptor Interaction.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		P7 D27 R33 K35 R36 F65
Binding residue
(residue number reindexed from 1)		P7 D27 R33 K35 R36 F65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zfm, PDBe:6zfm, PDBj:6zfm
PDBsum6zfm
PubMed33143415
UniProtP01391|3L21_NAJKA Alpha-cobratoxin

[Back to BioLiP]