Structure of PDB 6xwg Chain D Binding Site BS02

Receptor Information
>6xwg Chain D (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCI
INKVTRNRCQYCRLQKCFEVGMSKESVRND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xwg Structural basis for DNA recognition and allosteric control of the retinoic acid receptors RAR-RXR.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E106 G107 R114 R137 N138 Q141 R144
Binding residue
(residue number reindexed from 1)		E25 G26 R33 R56 N57 Q60 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6xwg, PDBe:6xwg, PDBj:6xwg
PDBsum6xwg
PubMed32974652
UniProtP10276|RARA_HUMAN Retinoic acid receptor alpha (Gene Name=RARA)

[Back to BioLiP]