BioLiP

Receptor Information

>6woo Chain D (length=295) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLV
VRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATG
LLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQR
TTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGG
HVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPA
FKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

>6woo Chain 7 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 E25 K27 T28 Y30 R33 R50 V52 R54 T56 N57 K58 I61 Q63 I65 I69 T70 G71 D72 V73 V74 Y79 H90 G91 N94 W95 Q151 R152 T155 G156 A157 R158 Y198 H203 V204 Y207 E221 K224 Y226 P255 T256 K258 F260 K262 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 K279 R285 V286 K289
Binding residue (residue number reindexed from 1)	K6 S8 S11 S12 F14 T16 F18 R19 R20 R22 E23 K25 T26 Y28 R31 R48 V50 R52 T54 N55 K56 I59 Q61 I63 I67 T68 G69 D70 V71 V72 Y77 H88 G89 N92 W93 Q149 R150 T153 G154 A155 R156 Y196 H201 V202 Y205 E219 K222 Y224 P253 T254 K256 F258 K260 Y263 A264 E266 S267 K268 Y270 R271 Q272 K274 L275 K277 R283 V284 K287

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:6woo, PDBe:6woo, PDBj:6woo
PDBsum	6woo
PubMed
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]

Structure of PDB 6woo Chain D Binding Site BS02