Structure of PDB 6wmi Chain D Binding Site BS02

Receptor Information
>6wmi Chain D (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCGKSFYVLQRL
KVHMRTHNGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGC
GRSFAEYSSLRKHLVVHSGEKPHQCQVCGKTFSQSGSRNVHMRKHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wmi ZNF410 Uniquely Activates the NuRD Component CHD4 to Silence Fetal Hemoglobin Expression.
Resolution2.75 Å
Binding residue
(original residue number in PDB)
Q264 K297 Y323 S324 R327
Binding residue
(residue number reindexed from 1)
Q48 K81 Y107 S108 R111
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wmi, PDBe:6wmi, PDBj:6wmi
PDBsum6wmi
PubMed33301730
UniProtQ86VK4|ZN410_HUMAN Zinc finger protein 410 (Gene Name=ZNF410)

[Back to BioLiP]