Structure of PDB 6vg8 Chain D Binding Site BS02

Receptor Information
>6vg8 Chain D (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGN
DENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKVTVDGPREPRRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vg8 Allosteric interference in oncogenic FLI1 and ERG transactions by mithramycins.
Resolution4.31 Å
Binding residue
(original residue number in PDB)
R190 R193 G194 K218 T220 V221 D222
Binding residue
(residue number reindexed from 1)
R80 R83 G84 K108 T110 V111 D112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6vg8, PDBe:6vg8, PDBj:6vg8
PDBsum6vg8
PubMed33275876
UniProtQ13950|RUNX2_HUMAN Runt-related transcription factor 2 (Gene Name=RUNX2)

[Back to BioLiP]