Structure of PDB 6tqr Chain D Binding Site BS02

Receptor Information
>6tqr Chain D (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRR
YCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSD
MEAVWKEAKPDELMDSKLRCVFEMPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqr FFAT motif phosphorylation controls formation and lipid transfer function of inter-organelle contacts.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		K50 K52 T53 T54 P56 N64 K94 M96
Binding residue
(residue number reindexed from 1)		K42 K44 T45 T46 P48 N56 K86 M88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005789 endoplasmic reticulum membrane

View graph for
Cellular Component
External links
PDB RCSB:6tqr, PDBe:6tqr, PDBj:6tqr
PDBsum6tqr
PubMed33124732
UniProtQ9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A (Gene Name=VAPA)

[Back to BioLiP]