Structure of PDB 6swa Chain D Binding Site BS02

Receptor Information
>6swa Chain D (length=294) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIV
RVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGL
LLARRLLNRFGMDKIYEGQVEVNGGEYNVESIDGQPGAFTCYLDAGLART
TTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQN
VADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVY
EKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES
Ligand information
>6swa Chain s (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcu
.<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K10 F13 K14 Y16 V18 F20 R21 R22 R24 T28 Y30 R33 R50 I52 R54 T56 N57 R58 I61 Q63 I69 E70 G71 D72 M73 I74 Y79 N94 R152 T154 T155 N157 K158 N203 Y207 Q222 F223 S224 Q225 K256 V261 K263 R265 W266 N267 R268 K270 M271 L273 K276 R279 V280 K284
Binding residue
(residue number reindexed from 1)		K7 F10 K11 Y13 V15 F17 R18 R19 R21 T25 Y27 R30 R47 I49 R51 T53 N54 R55 I58 Q60 I66 E67 G68 D69 M70 I71 Y76 N91 R149 T151 T152 N154 K155 N200 Y204 Q219 F220 S221 Q222 K253 V258 K260 R262 W263 N264 R265 K267 M268 L270 K273 R276 V277 K281
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swa, PDBe:6swa, PDBj:6swa
PDBsum6swa
PubMed33357414
UniProtP47962|RL5_MOUSE Large ribosomal subunit protein uL18 (Gene Name=Rpl5)

[Back to BioLiP]