Structure of PDB 6qtk Chain D Binding Site BS02

Receptor Information
>6qtk Chain D (length=192) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNV
EKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGA
HIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNP
EHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qtk Mechanistic and Structural Basis for the Actions of the Antibacterial Gepotidacin against Staphylococcus aureus Gyrase.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		E435 G436 D437 R458 G459 K460 D512
Binding residue
(residue number reindexed from 1)		E21 G22 D23 R44 G45 K46 D98
Enzymatic activity
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6qtk, PDBe:6qtk, PDBj:6qtk
PDBsum6qtk
PubMed30757898
UniProtP66937|GYRB_STAAN DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]