Structure of PDB 6qdv Chain D Binding Site BS02

Receptor Information
>6qdv Chain D (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMG
SSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIA
AEEQTAKRRKKRQKLKEKKLLAK
Ligand information
>6qdv Chain I (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaaugaugucauacuuauccucag
..........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		G73 S76
Binding residue
(residue number reindexed from 1)		G54 S57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtQ9H875|PKRI1_HUMAN PRKR-interacting protein 1 (Gene Name=PRKRIP1)

[Back to BioLiP]