Structure of PDB 6o7i Chain D Binding Site BS02

Receptor Information

>6o7i Chain D (length=272) Species: 523850 (Thermococcus onnurineus NA1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDRRFYGKIVIKGKIKAVTGLHIGSPVIKDPHTGLPYIPGSSLKGRLRSL
FEILVNSRLGEWREKYPSLANYSPGSCRPDNQENCGKFFNRKINRGWIHV
CPDYETALACPVCRLFGASGKESNFPSRIIVRDAFLTKEWEEKWRAGEAI
TEAKIEVGIDRVTSQANPRTNERVVAGAEFEFEIIYNVENTTHWRDDIKN
LLTAMALLEDSYLGGSGSRGYGKVKFIFDSFEFRPLDYYRTGKDEDIVSI
DAREKSVSDIFDSLFSEVEGKL

Ligand information

>6o7i Chain H (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caaaccgccucugcccgcg

...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6o7i Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	N106 K133 P180 R181
Binding residue (residue number reindexed from 1)	N94 K121 P168 R169

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0004519	endonuclease activity

	Biological Process
GO:0051607	defense response to virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6o7i, PDBe:6o7i, PDBj:6o7i
PDBsum	6o7i
PubMed	31326272
UniProt	B6YWC0

[Back to BioLiP]