Structure of PDB 6n8j Chain D Binding Site BS02

Receptor Information
>6n8j Chain D (length=255) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTN
KDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIAR
RTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGA
RVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQY
MEFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFFTKEQYAAESKKY
RQTKL
Ligand information
>6n8j Chain 2 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<......<...>...>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		S10 S13 T18 F20 R21 R22 R24 T28 Y30 R33 R54 T56 N57 K58 I69 T70 D72 V74 Y79 G91 N94 W95 R152 T154 T155 R158 Y198 H203 V204 Y207 E221 L222 K262 Q264 Y265 A266 E268 S269 Y272 Q274 K276 L277
Binding residue
(residue number reindexed from 1)		S3 S6 T11 F13 R14 R15 R17 T21 Y23 R26 R47 T49 N50 K51 I62 T63 D65 V67 Y72 G84 N87 W88 R145 T147 T148 R151 Y191 H196 V197 Y200 E205 L206 K240 Q242 Y243 A244 E246 S247 Y250 Q252 K254 L255
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
PDBsum6n8j
PubMed30814529
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]