Structure of PDB 6m62 Chain D Binding Site BS02

Receptor Information
>6m62 Chain D (length=276) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFT
NKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIA
RRTLQKLGLDEEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGL
YVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSE
LFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAAESKK
YRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6m62 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<.....<<.<<<<<........<<..............>>...
.......>>>>>..>><<<<<<.......<<<....<......>...>>>
.....>>>>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m62 Coupling of 5S RNP rotation with maturation of functional centers during large ribosomal subunit assembly.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R54 T56 N57 K58 D59 Q63 G71 D72 V74 Y79 N94 Q151 G156 R158 H203 V204 Y207 L222 F223 T256 K258 K259 F260 Y265 E268 S269 R273 Q274 K276 K279 R282 K289
Binding residue
(residue number reindexed from 1)		S7 S8 F10 T12 F14 R15 R16 R18 K21 T22 Y24 R27 R48 T50 N51 K52 D53 Q57 G65 D66 V68 Y73 N88 Q130 G135 R137 H182 V183 Y186 L201 F202 T235 K237 K238 F239 Y244 E247 S248 R252 Q253 K255 K258 R261 K268
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m62, PDBe:6m62, PDBj:6m62
PDBsum6m62
PubMed32719344
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]