Structure of PDB 6lbi Chain D Binding Site BS02

Receptor Information
>6lbi Chain D (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSAGWKNS
IRHNLSLHSKFIRVQNEGTGKSSWWMLNPEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lbi Mechanism of forkhead transcription factors binding to a novel palindromic DNA site.
Resolution3.067 Å
Binding residue
(original residue number in PDB)		L183 R214 H215 S218 R225 S234 S235 W237
Binding residue
(residue number reindexed from 1)		L24 R52 H53 S56 R63 S72 S73 W75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lbi, PDBe:6lbi, PDBj:6lbi
PDBsum6lbi
PubMed33577686
UniProtQ12778|FOXO1_HUMAN Forkhead box protein O1 (Gene Name=FOXO1)

[Back to BioLiP]