Structure of PDB 6lb3 Chain D Binding Site BS02

Receptor Information
>6lb3 Chain D (length=92) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADM
AIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lb3 Crystal structure of PA4674 in complex with its operator DNA (18bp) from Pseudomonas aeruginosa
Resolution2.497 Å
Binding residue
(original residue number in PDB)
S37 P39 T40 R49 G50 S52
Binding residue
(residue number reindexed from 1)
S32 P34 T35 R44 G45 S47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6lb3, PDBe:6lb3, PDBj:6lb3
PDBsum6lb3
PubMed
UniProtQ9HVC1

[Back to BioLiP]