Structure of PDB 6lau Chain D Binding Site BS02

Receptor Information
>6lau Chain D (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVKRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Ligand information
>6lau Chain B (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcauugugccucgcauugcacuccgcggggcgauaaguccugaaaaggg
auguc
.<<<<<.<<<<<<<<..........>>>>>>>>......<<<....>>>>
>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lau SAM-VI riboswitch structure and signature for ligand discrimination.
Resolution3.109 Å
Binding residue
(original residue number in PDB)		E25 K28
Binding residue
(residue number reindexed from 1)		E19 K22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6lau, PDBe:6lau, PDBj:6lau
PDBsum6lau
PubMed31844059
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]