Structure of PDB 6jm9 Chain D Binding Site BS02

Receptor Information
>6jm9 Chain D (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6jm9 Chain J (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagattctaccaaaagtgtatttggaaactgctccatcaaaaggcatgt
tcagctgaattcagctgaacatgccttttgatggagcagtttccaaatac
acttttggtagaatctgcaggtg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jm9 Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
Resolution7.3 Å
Binding residue
(original residue number in PDB)
R30 K31 E32 S33 I36
Binding residue
(residue number reindexed from 1)
R2 K3 E4 S5 I8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6jm9, PDBe:6jm9, PDBj:6jm9
PDBsum6jm9
PubMed30923167
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]