Structure of PDB 6ipu Chain D Binding Site BS02

Receptor Information
>6ipu Chain D (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>6ipu Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ipu PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution1.99 Å
Binding residue
(original residue number in PDB)
R28 K31 E32 S33 Y37
Binding residue
(residue number reindexed from 1)
R1 K4 E5 S6 Y10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6ipu, PDBe:6ipu, PDBj:6ipu
PDBsum6ipu
PubMed31848352
UniProtP06899|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)

[Back to BioLiP]