Structure of PDB 6igs Chain D Binding Site BS02

Receptor Information

>6igs Chain D (length=158) Species: 263 (Francisella tularensis)

TYSAENTEVYITSQQLEQAVTRLAEQINQDYSGQQVTLVCVLKGSFMFFA
DLVRKLRIDLRTQFITASSKEEYVKDKNIIIIEDIVDTGHTYHKLIEGIG
KYNPKTLKFATLLFKPARLERDVKLDYVCFEIEDKFIVGYGLDFDEKYRE
LPYIGLIK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6igs Chain D Residue 204

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6igs Crystal structure of hypoxanthine phosphoribosyltransferase from Francisella tularensis
• Resolution: 2.16 Å
• Binding residue (original residue number in PDB): H109 H112 E139
• Binding residue (residue number reindexed from 1): H90 H93 E120
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): E102 D103 D106 F155 R168
• Catalytic site (residue number reindexed from 1): E83 D84 D87 F136 R149
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6igs, PDBe:6igs, PDBj:6igs
• PDBsum: 6igs
• UniProt: Q5NI77