Structure of PDB 6i5j Chain D Binding Site BS02

Receptor Information
>6i5j Chain D (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSD
YLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYY
VQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIW
GLPLPTRLKDYLEEYKFQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i5j Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		M132 X133 R137 T147 V148 H149
Binding residue
(residue number reindexed from 1)		M103 X104 R108 T118 V119 H120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:6i5j, PDBe:6i5j, PDBj:6i5j
PDBsum6i5j
PubMed31182716
UniProtO14508|SOCS2_HUMAN Suppressor of cytokine signaling 2 (Gene Name=SOCS2)

[Back to BioLiP]