Structure of PDB 6hb4 Chain D Binding Site BS02

Receptor Information
>6hb4 Chain D (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hb4 DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region.
Resolution3.05 Å
Binding residue
(original residue number in PDB)
V54 L58 K62 T77 K139 R140 M143 K146 K147 R157 Y162 Q179 L182 K186 W189 Y211 R232 R233
Binding residue
(residue number reindexed from 1)
V11 L15 K19 T34 K96 R97 M100 K103 K104 R114 Y119 Q136 L139 K143 W146 Y168 R189 R190
Binding affinityPDBbind-CN: Kd=4.4nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hb4, PDBe:6hb4, PDBj:6hb4
PDBsum6hb4
PubMed31114891
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]