Structure of PDB 6gqv Chain D Binding Site BS02

Receptor Information
>6gqv Chain D (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6gqv Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gqv Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		D6 A7 S10 S13 S14 F16 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 I65 T70 G71 D72 V73 V74 Y79 N94 W95 R152 T154 T155 A157 R158 F185 H203 Y207 R218 L222 F223 Y226 T256 K259 F260 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 V286 K289
Binding residue
(residue number reindexed from 1)		D5 A6 S9 S12 S13 F15 F19 R20 R21 R23 T27 Y29 R32 R49 R53 T55 N56 K57 I64 T69 G70 D71 V72 V73 Y78 N93 W94 R151 T153 T154 A156 R157 F184 H202 Y206 R217 L221 F222 Y225 T255 K258 F259 Y264 A265 E267 S268 K269 Y271 R272 Q273 K275 L276 V285 K288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gqv, PDBe:6gqv, PDBj:6gqv
PDBsum6gqv
PubMed29886014
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]