Structure of PDB 6gqb Chain D Binding Site BS02

Receptor Information
>6gqb Chain D (length=296) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6gqb Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		D6 S13 S14 F16 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 F55 N57 D59 Q63 I65 I69 T70 D72 V73 V74 Y79 N94 R152 T155 G156 A157 R158 H203 Y207 R218 E221 K224 Y226 F253 K258 K259 F260 K262 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 K279 R282 R285
Binding residue
(residue number reindexed from 1)		D5 S12 S13 F15 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 F54 N56 D58 Q62 I64 I68 T69 D71 V72 V73 Y78 N93 R151 T154 G155 A156 R157 H202 Y206 R217 E220 K223 Y225 F252 K257 K258 F259 K261 Y264 A265 E267 S268 K269 Y271 R272 Q273 K275 L276 K278 R281 R284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
PDBsum6gqb
PubMed29886014
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]