Structure of PDB 6gej Chain D Binding Site BS02

Receptor Information

>6gej Chain D (length=80) Species: 559292 (Saccharomyces cerevisiae S288C)

RDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTY
TEHAKRKTVTSLDVVYALKRQGRTLYGFGG

Ligand information

>6gej Chain J (length=154)

tgcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctccag
ggcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6gej Structure and dynamics of the yeast SWR1-nucleosome complex.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): R35 R45 I46 S47 R78 T80
• Binding residue (residue number reindexed from 1): R13 R23 I24 S25 R56 T58

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0042802 identical protein binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0006355 regulation of DNA-templated transcription
• GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
• GO:0045943 positive regulation of transcription by RNA polymerase I

Cellular Component

• GO:0000500 RNA polymerase I upstream activating factor complex
• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0031298 replication fork protection complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:6gej, PDBe:6gej, PDBj:6gej
• PDBsum: 6gej
• PubMed: 30309918
• UniProt: P02309|H4_YEAST Histone H4 (Gene Name=HHF1)