Structure of PDB 6fyx Chain D Binding Site BS02

Receptor Information
>6fyx Chain D (length=227) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRA
TKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKF
ADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKAL
PDAVTIIEPKEEEPVLEPSVKDYRPTE
Ligand information
>6fyx Chain 3 (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucuaacuauaaaaaugucucuucucucucu
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fyx Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R94 R116 R117 R143 A144 R146 K148
Binding residue
(residue number reindexed from 1)		R92 R114 R115 R141 A142 R144 K146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fyx, PDBe:6fyx, PDBj:6fyx
PDBsum6fyx
PubMed30475211
UniProtQ6CRK7

[Back to BioLiP]