Structure of PDB 6fqm Chain D Binding Site BS02

Receptor Information
>6fqm Chain D (length=150) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPECEIFLVEGDDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAF
GTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAG
YVYIAQPLLWETTRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fqm A new class of antibacterials, the imidazopyrazinones, reveal structural transitions involved in DNA gyrase poisoning and mechanisms of resistance.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		K460 L462 N463 K466 N475 H515 V626 R629
Binding residue
(residue number reindexed from 1)		K25 L27 N28 K31 N40 H80 V139 R142
Enzymatic activity
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fqm, PDBe:6fqm, PDBj:6fqm
PDBsum6fqm
PubMed29538767
UniProtP66937|GYRB_STAAN DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]