Structure of PDB 6fq6 Chain D Binding Site BS02

Receptor Information
>6fq6 Chain D (length=90) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>6fq6 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fq6 Structural rearrangements of the histone octamer translocate DNA.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		E32 S33 I36 Y37 K40
Binding residue
(residue number reindexed from 1)		E1 S2 I5 Y6 K9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6fq6, PDBe:6fq6, PDBj:6fq6
PDBsum6fq6
PubMed29626188
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]