Structure of PDB 6dat Chain D Binding Site BS02

Receptor Information
>6dat Chain D (length=135) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQ
SFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNI
IHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Ligand information
>6dat Chain F (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSFDSFDFEDFPAALW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dat The Biophysical Basis for Phosphorylation-Enhanced DNA-Binding Autoinhibition of the ETS1 Transcription Factor.
Resolution2.35003 Å
Binding residue
(original residue number in PDB)		P334 K379
Binding residue
(residue number reindexed from 1)		P33 K78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6dat, PDBe:6dat, PDBj:6dat
PDBsum6dat
PubMed30597162
UniProtP27577|ETS1_MOUSE Protein C-ets-1 (Gene Name=Ets1)

[Back to BioLiP]