Structure of PDB 6d6v Chain D Binding Site BS02

Receptor Information
>6d6v Chain D (length=185) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGK
SVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQL
INQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENK
EFNNEQEIAYKVLKIEKENIKEESKYLLKKLEHLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d6v Structure of Telomerase with Telomeric DNA.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		Q558 G559 K560 S561 V562 K564 Y565 H566 S569 E573 S574 R588 M601 F603 K660
Binding residue
(residue number reindexed from 1)		Q48 G49 K50 S51 V52 K54 Y55 H56 S59 E63 S64 R78 M91 F93 K150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding
GO:0043047 single-stranded telomeric DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0007004 telomere maintenance via telomerase
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d6v, PDBe:6d6v, PDBj:6d6v
PDBsum6d6v
PubMed29775593
UniProtD2CVN6|TEB1_TETTS Telomeric repeat-binding subunit 1 (Gene Name=TEB1)

[Back to BioLiP]