Structure of PDB 6c2f Chain D Binding Site BS02

Receptor Information
>6c2f Chain D (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL
GNTVDLSSFDFRTGKMMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c2f MBD2 in complex with methylated DNA
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R166 K167 S168 G169 L170 S171 K186
Binding residue
(residue number reindexed from 1)		R19 K20 S21 G22 L23 S24 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c2f, PDBe:6c2f, PDBj:6c2f
PDBsum6c2f
PubMed
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]