Structure of PDB 6c1t Chain D Binding Site BS02

Receptor Information
>6c1t Chain D (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLG
NTVDLSSFDFRTGKMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1t Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.
Resolution1.84 Å
Binding residue
(original residue number in PDB)		R166 S168 G169 L170 S171
Binding residue
(residue number reindexed from 1)		R18 S20 G21 L22 S23
Binding affinityPDBbind-CN: Kd=3.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c1t, PDBe:6c1t, PDBj:6c1t
PDBsum6c1t
PubMed29567833
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]