Structure of PDB 6bzw Chain D Binding Site BS02

Receptor Information
>6bzw Chain D (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLL
IYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPWT
FGGGTKLEIKRADAAPTVSIFPPSSEQLTSGTASVVCLLNNFYPREAKVQ
WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSPVTKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bzw Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S7 T20 S22 R24 D70 F71 T72
Binding residue
(residue number reindexed from 1)		S6 T19 S21 R23 D73 F74 T75
External links